HPA027104

ADPRHL2 antibody from Sigma-Aldrich
ARH3, FLJ20446
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027104
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027104, RRID:AB_10601330
Product name
Anti-ADPRHL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027104
Antibody type
Polyclonal
Antigen
ADP-ribosylhydrolase like 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPY
SSRLKKIGELLDQASVTREEVVSELGNGIAAFESV
PTAIYCFLR
Storage
-20C
Provider Type Product Number
- No reagents -