HPA027141

ADPRS antibody from MilliporeSigma / Merck KGaA
ADPRHL2, ARH3, FLJ20446
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027141
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ADPRHL2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027141
Antibody type
Polyclonal
Antigen
Poly recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT
EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFA
QEYKKDPDRGYGAGVV
Storage
-20C