HPA005799

TBX3 antibody from Sigma-Aldrich
TBX3-ISO, UMS, XHL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005799
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005799, RRID:AB_1857817
Product name
Anti-TBX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005799
Antibody type
Polyclonal
Antigen
T-box transcription factor TBX3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSMRVFDERHKKENGTSDESSSEQAAFNCFAQASS
PAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEA
CDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRD
SGRLDKASPDSRHSPATISSSTR
Storage
-20C
Provider Type Product Number
- No reagents -