H00008189-A01

SYMPK antibody from Abnova Corporation
SPK, SYM
No application information provided.

Antibody data

Product number
H00008189-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008189-A01, RRID:AB_1139226
Product name
SYMPK polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00008189-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant SYMPK.
Antigen sequence
MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSER
VVDLLNQAALITNDSKITVLKQVQELIINKDPTLL
DNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIE
LLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVA
LQWMVKSRVISELQEACWDMVSAMAGDIILLLDSD
NDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHD
ISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVH
PAISSINLTTALGSLANIARQRPMFMSEVIQAYET
LHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASL
EFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPR
DDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKA
SAQISGQSDTDITAEFLQPLLTPDNVANLVLISMV
YLPEAMPASFQAIYTPVESAGTEAQIKHLARLMAT
QMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIK
RRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEP
IIPVTQPR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -