Antibody data

Product number
H00118980-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00118980-B02, RRID:AB_1204971
Product name
SFXN2 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00118980-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SFXN2 protein.
Antigen sequence
MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRT
VFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYA
KKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGF
MLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASP
TSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLV
GRWVPFAAVAAANCVNIPMMRQQELIKGICVKDRN
ENEIGHSRRAAAIGITQVVISRITMSAPGMILLPV
IMERLEKLHFMQKVKVLHAPLQVMLSGCFLIFMVP
VACGLFPQKCELPVSYLEPKLQDTIKAKYGELEPY
VYFNKGL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -