ABIN1449857
antibody from antibodies-online
Targeting: ZSCAN12
dJ29K1.2, KIAA0426, ZFP96, ZNF29K1, ZNF305, ZNF96
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449857 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and SCAN Domain Containing 12 (ZSCAN12) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the middle region of human ZSCAN12
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLD
VETGNEYGNLKQEVS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Transfected 293T; WB Suggested Anti-ZSCAN12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T; ZSCAN12 antibody - middle region (AP44092PU-N) in Transfected 293T cells using Western Blot