H00025865-B01

PRKD2 antibody from Abnova Corporation
DKFZP586E0820, HSPC187, PKD2

Antibody data

Product number
H00025865-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025865-B01, RRID:AB_982798
Product name
PRKD2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00025865-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PRKD2 protein.
Antigen sequence
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLL
PQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANL
LQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLN
YHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASS
YTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCL
GEALINGDVPMEEATDFSEADKSALMDESEDSGVI
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVV
QSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNF
SLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPH
RQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQL
RNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHL
HFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMW
SVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHP
WLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERI
SVL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -