ABIN1109360

antibody from antibodies-online

Targeting: TSC22D4 THG-1, TILZ2

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN1109360

Provider

antibodies-online

Product name

anti-TSC22 Domain Family, Member 4 (TSC22D4) (N-Term) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4

Description

Protein A affinity column

Reactivity

Human, Porcine

Host

Rabbit

Antigen sequence

SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPP
TGPPPRLPNGEPSPD


Epitope

N-Term

Vial size

0.1 mg

Storage

Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term

Handling

Avoid repeated freezing and thawing.

References

Submitted references

Human chromosome 7: DNA sequence and biology.

Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Döhner H, Döhner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC
Science (New York, N.Y.) 2003 May 2;300(5620):767-72

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Human HepG2; WB Suggested Anti-TSC22D4 Antibody Titration: 0.5ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human HepG2 cells using Western Blot

Immunohistochemistry

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Human Lung; Rabbit Anti-TSC22D4 Antibody. Paraffin Embedded Tissue: Human Lung. Cellular Data: Alveolar cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human Lung cells using Immunohistochemistry

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Human kidney; Rabbit Anti-TSC22D4 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human kidney cells using Immunohistochemistry