HPA006982

TSHZ1 antibody from Sigma-Aldrich
NY-CO-33, SDCCAG33, TSH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006982
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006982, RRID:AB_1079886
Product name
Anti-TSHZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006982
Antibody type
Polyclonal
Antigen
Teashirt homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSY
PQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTT
STNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTS
CSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSS
YGLLPEPS
Storage
-20C
Provider Type Product Number
- No reagents -