HPA024331

ZSCAN2 antibody from Sigma-Aldrich
FLJ20595, ZFP29, ZNF854
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024331
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024331, RRID:AB_1859497
Product name
Anti-ZSCAN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024331
Antibody type
Polyclonal
Antigen
Zinc finger and SCAN domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMH
TGEKPYECLTCGESFSWSSNLLKHQRIHTGEKPYK
CSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKS
FSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVL
II
Storage
-20C
Provider Type Product Number
- No reagents -