Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183734 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TAR DNA Binding Protein (TARDBP) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQF
PGACG LRYRNPVSQC- Vial size
- 0.1 mg
Submitted references Wild-type and A315T mutant TDP-43 exert differential neurotoxicity in a Drosophila model of ALS.
TDP-43 binds heterogeneous nuclear ribonucleoprotein A/B through its C-terminal tail: an important region for the inhibition of cystic fibrosis transmembrane conductance regulator exon 9 splicing.
Estes PS, Boehringer A, Zwick R, Tang JE, Grigsby B, Zarnescu DC
Human molecular genetics 2011 Jun 15;20(12):2308-21
Human molecular genetics 2011 Jun 15;20(12):2308-21
TDP-43 binds heterogeneous nuclear ribonucleoprotein A/B through its C-terminal tail: an important region for the inhibition of cystic fibrosis transmembrane conductance regulator exon 9 splicing.
Buratti E, Brindisi A, Giombi M, Tisminetzky S, Ayala YM, Baralle FE
The Journal of biological chemistry 2005 Nov 11;280(45):37572-84
The Journal of biological chemistry 2005 Nov 11;280(45):37572-84
No comments: Submit comment
No validations: Submit validation data