HPA020339

ATXN2 antibody from Sigma-Aldrich
ATX2, SCA2, TNRC13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020339
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020339, RRID:AB_1845131
Product name
Anti-ATXN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020339
Antibody type
Polyclonal
Antigen
Ataxin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGHSINTRENKYIPPGQRNREVISWGSGRQNSPRM
GQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVP
WPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPS
RPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSE
Storage
-20C
Provider Type Product Number
- No reagents -