HPA023322

MARCH10 antibody from Sigma-Aldrich
FLJ35757, MARCH-X, RNF190
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023322
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023322, RRID:AB_1856351
Product name
Anti-MARCH10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023322
Antibody type
Polyclonal
Antigen
Probable E3 ubiquitin-protein ligase MARCH10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEV
GVNAENVWSDCISVEHRPGTHDSEGYWKDYLNSSQ
NSLDYFISGRPISPRSSVNSSYNPPAS
Storage
-20C
Provider Type Product Number
- No reagents -