HPA006748

FEN1 antibody from Sigma-Aldrich
FEN-1, MF1, RAD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006748
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006748, RRID:AB_1848494
Product name
Anti-FEN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006748
Antibody type
Polyclonal
Antigen
Flap endonuclease 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTAS
EAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGS
DYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNK
YPVPENWLHKEAHQLFLEPEVLDPESVELKW
Storage
-20C
Provider Type Product Number
- No reagents -