HPA021497

RBM33 antibody from Atlas Antibodies
DKFZp434D1319, DKFZp686F102, MGC20460, PRR8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021497
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021497, RRID:AB_2176261
Product name
Anti-RBM33
Provider product page
Atlas Antibodies - HPA021497
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGARKKELLERLAQQQQQLYAPPPPAEQEEQALSP
SPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISN
VQPKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -