Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 41970002 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#41970002, RRID:AB_10708817
- Product name
- Rabbit Polyclonal SUN1 Antibody
- Antibody type
- Polyclonal
- Description
- Immunogen affinity purified. Caenorhabditis elegans SUN1
- Host
- Rabbit
- Antigen sequence
DGTHHNSEGSYADKDANWASEKQKFHQTISNLRAE
FSAHDKQLDFKTDHLEKLLENVLEHSKGWKESAIE
ELKQIKLWQAEISDALQQMKKEIDDAKSTK- Isotype
- IgG
- Vial size
- 0.05 mg
- Concentration
- 1 mg/ml
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977 Dilution: 1:1000 Affinity purified
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2945 Dilution: 1:1000
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977. Wild type gonad Affinity purified, dilution: 1:1000
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2945 Dilution: 1:10000