Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503945 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 2 (SERPINB2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFE
KKLNG LYPFRVNSAQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Preclinical evaluation of 213Bi-labeled plasminogen activator inhibitor type 2 in an orthotopic murine xenogenic model of human breast carcinoma.
A structural basis for differential cell signalling by PAI-1 and PAI-2 in breast cancer cells.
Stutchbury TK, Al-Ejeh F, Stillfried GE, Croucher DR, Andrews J, Irving D, Links M, Ranson M
Molecular cancer therapeutics 2007 Jan;6(1):203-12
Molecular cancer therapeutics 2007 Jan;6(1):203-12
A structural basis for differential cell signalling by PAI-1 and PAI-2 in breast cancer cells.
Croucher DR, Saunders DN, Stillfried GE, Ranson M
The Biochemical journal 2007 Dec 1;408(2):203-10
The Biochemical journal 2007 Dec 1;408(2):203-10
No comments: Submit comment
No validations: Submit validation data