H00003556-M01

IL1RAP antibody from Abnova Corporation
C3orf13, IL-1RAcP, IL1R3
No application information provided.

Antibody data

Product number
H00003556-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003556-M01, RRID:AB_1576280
Product name
IL1RAP monoclonal antibody (M01), clone 3D9
Provider product page
Abnova Corporation - H00003556-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant IL1RAP.
Antigen sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQI
QVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTL
LNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTI
TWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY
TCVVTYPENGRTFHLTRTPTVKVVGSPKNAVPPVI
HSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV
WWTIDGKKPDDITIDVTINESISHSRTEDETRTQI
LSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK
GNRCGQ
Isotype
IgG
Antibody clone number
3D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -