Antibody data

Product number
ABIN632600
Provider
antibodies-online
Product name
anti-Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP) (Middle Region) antibody
Provider product page
antibodies-online - ABIN632600
Antibody type
Polyclonal
Antigen
LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Description
Affinity purified
Reactivity
Human
Host
Rabbit
Epitope
Middle Region
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -