H00026135-B01P

SERBP1 antibody from Abnova Corporation
CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1

Antibody data

Product number
H00026135-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026135-B01P, RRID:AB_1580483
Product name
SERBP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026135-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SERBP1 protein.
Antigen sequence
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAE
NKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEG
IRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGR
GRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL
KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYN
YSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV
KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGA
DGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRG
SRTDKSSASAPDVDDPEAFPALA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -