Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502911 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Calponin 1 (CNN1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CNN1 antibody: synthetic peptide directed towards the N terminal of human CNN1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELR
EWIEG VTGRRIGNNF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Reduction of Calponin h1 expression in human colon cancer blood vessels.
Yanagisawa Y, Takeoka M, Ehara T, Itano N, Miyagawa S, Taniguchi S
European journal of surgical oncology : the journal of the European Society of Surgical Oncology and the British Association of Surgical Oncology 2008 May;34(5):531-7
European journal of surgical oncology : the journal of the European Society of Surgical Oncology and the British Association of Surgical Oncology 2008 May;34(5):531-7
No comments: Submit comment
No validations: Submit validation data