ABIN629711

antibody from antibodies-online

Targeting: AKAP7 AKAP15, AKAP18

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629711 - Provider product page
Provider: antibodies-online
Product name: anti-A Kinase (PRKA) Anchor Protein 7 (AKAP7) antibody
Antibody type: Polyclonal
Antigen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

AKAP7 protein structure - ABIN629711 shown in red.