Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406016 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutaminyl-Peptide Cyclotransferase (QPCT) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-QPCT antibody: synthetic peptide directed towards the middle region of human QPCT
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLI
GAPNP TFPNFFPNSA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Isolation of an isoenzyme of human glutaminyl cyclase: retention in the Golgi complex suggests involvement in the protein maturation machinery.
Cynis H, Rahfeld JU, Stephan A, Kehlen A, Koch B, Wermann M, Demuth HU, Schilling S
Journal of molecular biology 2008 Jun 20;379(5):966-80
Journal of molecular biology 2008 Jun 20;379(5):966-80
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting