HPA026532

FAAP100 antibody from MilliporeSigma / Merck KGaA
C17orf70, FLJ22175
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026532
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026532, RRID:AB_1845603
Product name
Anti-C17orf70 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026532
Antibody type
Polyclonal
Antigen
Fanconi anemia-associated protein of 100 kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLCSVSPSGSRVPHDLLGGSGGFTLEDALFGLLFG
ADATLLQSPVVLCGLPDGQLCCVILKALVTSRSAP
GDPNALVKILHHLEEPVIFIGALKTEPQAAEAAEN
FLPDEDVHCDC
Storage
-20C
Provider Type Product Number
- No reagents -