Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504562 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pleiomorphic Adenoma Gene-Like 1 (PLAGL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PLAGL1 antibody: synthetic peptide directed towards the N terminal of human PLAGL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLG
YKRHL ALHAASSGDL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Preferential loss of the nonimprinted allele for the ZAC1 tumor suppressor gene in human capillary hemangioblastoma.
Lemeta S, Jarmalaite S, Pylkkänen L, Böhling T, Husgafvel-Pursiainen K
Journal of neuropathology and experimental neurology 2007 Sep;66(9):860-7
Journal of neuropathology and experimental neurology 2007 Sep;66(9):860-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting