HPA023371

DCXR antibody from Sigma-Aldrich
DCR, KIDCR, SDR20C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023371
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023371, RRID:AB_1847530
Product name
Anti-DCXR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023371
Antibody type
Polyclonal
Antigen
L-xylulose reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPL
GKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG
Storage
-20C
Provider Type Product Number
- No reagents -