HPA001419

C22orf29 antibody from Sigma-Aldrich
FLJ21125
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001419
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001419, RRID:AB_1078999
Product name
Anti-GNB1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001419
Antibody type
Polyclonal
Antigen
Uncharacterized protein C22orf29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTP
GPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPV
PRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETE
GDQEVSLGTPQEVVEAPETPGEPPLSP
Storage
-20C
Provider Type Product Number
- No reagents -