HPA025235

VANGL1 antibody from Sigma-Aldrich
STB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025235
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025235, RRID:AB_1858718
Product name
Anti-VANGL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025235
Antibody type
Polyclonal
Antigen
Vang-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRN
KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDN
WGETTTAITGTSEHSISQEDIARISKDMEDSVGLD
CKRY
Storage
-20C
Provider Type Product Number
- No reagents -