HPA007227

FAM198B antibody from Atlas Antibodies
C4orf18, DKFZp434L142, FLJ38155
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007227
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007227, RRID:AB_1234171
Product name
Anti-FAM198B
Provider product page
Atlas Antibodies - HPA007227
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAA
EKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGST
LQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVA
SAAPGQEALVGPSLQPQEAAREADAVAPGYA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -