HPA007227

FAM198B antibody from Sigma-Aldrich
C4orf18, DKFZp434L142, FLJ38155
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007227
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007227, RRID:AB_1847689
Product name
Anti-C4orf18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007227
Antibody type
Polyclonal
Antigen
Uncharacterized protein C4orf18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAA
EKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGST
LQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVA
SAAPGQEALVGPSLQPQEAAREADAVAPGYA
Storage
-20C
Provider Type Product Number
- No reagents -