Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 103-PA46 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Gremlin-1
- Antibody type
- Polyclonal
- Antigen
- Recombinant mouse Gremlin-1
- Description
- antibody Protein-A purified from serum
- Reactivity
- Mouse
- Host
- Rabbit
- Antigen sequence
MKKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTR
GRGQGRGTAMPGEEVLESSQEALHVTERKYLKRDW
CKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIP
RHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQP
PTKKKRVTRVKQCRCISIDLD- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western Analysis of anti-mouse Gremlin-1. Samples were loaded in 15% SDS-polyacrylamide gel under reducing conditions. Lane 1: MWM (kDa); lane 2: rm Grem1; lane 3: rh Grem1; lane 4: rh Grem1.
- Sample type
- Purified recombinant proteins