Antibody data

Product number
H00005710-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005710-M01, RRID:AB_1579276
Product name
PSMD4 monoclonal antibody (M01), clone 3C9
Provider product page
Abnova Corporation - H00005710-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PSMD4.
Antigen sequence
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNI
VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNH
KMRII
Isotype
IgG
Antibody clone number
3C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -