HPA017254

STK11 antibody from Sigma-Aldrich
LKB1, PJS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017254
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017254, RRID:AB_1852924
Product name
Anti-STK11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017254
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVK
EVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEI
QLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVC
GMQEMLDSVPEKRFPVCQ
Storage
-20C
Provider Type Product Number
- No reagents -