HPA009027

ULK2 antibody from Atlas Antibodies
ATG1B, KIAA0623, Unc51.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009027
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009027, RRID:AB_1080458
Product name
Anti-ULK2
Provider product page
Atlas Antibodies - HPA009027
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLST
GSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSR
NSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNK
QKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTS
PTKH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -