Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310536 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC30A1 antibody: synthetic peptide directed towards the middle region of human SLC30A1
- Description
- Affinity Purified
- Reactivity
- Human, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLY
LDPTL CVVMVCILLY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cobalt chloride speciation, mechanisms of cytotoxicity on human pulmonary cells, and synergistic toxicity with zinc.
Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
Bresson C, Darolles C, Carmona A, Gautier C, Sage N, Roudeau S, Ortega R, Ansoborlo E, Malard V
Metallomics : integrated biometal science 2013 Feb;5(2):133-43
Metallomics : integrated biometal science 2013 Feb;5(2):133-43
Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
Overbeck S, Uciechowski P, Ackland ML, Ford D, Rink L
Journal of leukocyte biology 2008 Feb;83(2):368-80
Journal of leukocyte biology 2008 Feb;83(2):368-80
No comments: Submit comment
No validations: Submit validation data