H00130399-M01

ACVR1C antibody from Abnova Corporation
ACVRLK7, ALK7

Antibody data

Product number
H00130399-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00130399-M01, RRID:AB_1571128
Product name
ACVR1C monoclonal antibody (M01), clone 2E3
Provider product page
Abnova Corporation - H00130399-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ACVR1C.
Antigen sequence
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKE
QVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFC
NNITLHLPTASPNAPKLGPM
Isotype
IgG
Antibody clone number
2E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -