Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502942 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-AarF Domain Containing Kinase 3 (ADCK3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CABC1 antibody: synthetic peptide directed towards the N terminal of human CABC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAK ARPENKQHKQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ADCK3, an ancestral kinase, is mutated in a form of recessive ataxia associated with coenzyme Q10 deficiency.
Lagier-Tourenne C, Tazir M, López LC, Quinzii CM, Assoum M, Drouot N, Busso C, Makri S, Ali-Pacha L, Benhassine T, Anheim M, Lynch DR, Thibault C, Plewniak F, Bianchetti L, Tranchant C, Poch O, DiMauro S, Mandel JL, Barros MH, Hirano M, Koenig M
American journal of human genetics 2008 Mar;82(3):661-72
American journal of human genetics 2008 Mar;82(3):661-72
No comments: Submit comment
No validations: Submit validation data