H00005603-M06A

MAPK13 antibody from Abnova Corporation
p38delta, PRKM13, SAPK4

Antibody data

Product number
H00005603-M06A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005603-M06A, RRID:AB_1204653
Product name
MAPK13 monoclonal antibody (M06A), clone 3D8
Provider product page
Abnova Corporation - H00005603-M06A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPK13.
Antigen sequence
NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLL
EKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEA
QQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARK
DSRRRSGMKL
Isotype
IgG
Antibody clone number
3D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -