Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002049-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002049-M10, RRID:AB_530036
- Product name
- EPHB3 monoclonal antibody (M10), clone 3F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPHB3.
- Antigen sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDW
LDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRI
GVTLAGHQKKILSSIQDMRLQMNQTLPVQ- Isotype
- IgG
- Antibody clone number
- 3F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EPHB3 expression in transfected 293T cell line by EPHB3 monoclonal antibody (M10), clone 3F12.Lane 1: EPHB3 transfected lysate (Predicted MW: 110.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of EPHB3 transfected lysate using anti-EPHB3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EPHB3 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol