HPA014550

TMEM14EP antibody from Atlas Antibodies
TMEM14E
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014550
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014550, RRID:AB_1670035
Product name
Anti-TMEM14EP
Provider product page
Atlas Antibodies - HPA014550
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVGSVQSPSAGFFFSELAGLDASQPSRNPKEHLSS
PVYIWDLARYYAN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -