Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184363 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nucleobindin 1 (NUCB1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NUCB1 antibody: synthetic peptide directed towards the C terminal of human NUCB1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEK
KLLER LPEVEVPQHL- Vial size
- 50 µg
Submitted references Topology and membrane anchoring of the lysosomal storage disease-related protein CLN5.
Calnuc plays a role in dynamic distribution of Galphai but not Gbeta subunits and modulates ACTH secretion in AtT-20 neuroendocrine secretory cells.
Modulation of nucleobindin-1 and nucleobindin-2 by caspases.
Serine 129 phosphorylation of alpha-synuclein induces unfolded protein response-mediated cell death.
Calnuc binds to Alzheimer's beta-amyloid precursor protein and affects its biogenesis.
Structural studies on the Ca2+-binding domain of human nucleobindin (calnuc).
Larkin H, Ribeiro MG, Lavoie C
Human mutation 2013 Dec;34(12):1688-97
Human mutation 2013 Dec;34(12):1688-97
Calnuc plays a role in dynamic distribution of Galphai but not Gbeta subunits and modulates ACTH secretion in AtT-20 neuroendocrine secretory cells.
Lin P, Fischer T, Lavoie C, Huang H, Farquhar MG
Molecular neurodegeneration 2009 Mar 25;4:15
Molecular neurodegeneration 2009 Mar 25;4:15
Modulation of nucleobindin-1 and nucleobindin-2 by caspases.
Valencia CA, Cotten SW, Duan J, Liu R
FEBS letters 2008 Jan 23;582(2):286-90
FEBS letters 2008 Jan 23;582(2):286-90
Serine 129 phosphorylation of alpha-synuclein induces unfolded protein response-mediated cell death.
Sugeno N, Takeda A, Hasegawa T, Kobayashi M, Kikuchi A, Mori F, Wakabayashi K, Itoyama Y
The Journal of biological chemistry 2008 Aug 22;283(34):23179-88
The Journal of biological chemistry 2008 Aug 22;283(34):23179-88
Calnuc binds to Alzheimer's beta-amyloid precursor protein and affects its biogenesis.
Lin P, Li F, Zhang YW, Huang H, Tong G, Farquhar MG, Xu H
Journal of neurochemistry 2007 Mar;100(6):1505-14
Journal of neurochemistry 2007 Mar;100(6):1505-14
Structural studies on the Ca2+-binding domain of human nucleobindin (calnuc).
de Alba E, Tjandra N
Biochemistry 2004 Aug 10;43(31):10039-49
Biochemistry 2004 Aug 10;43(31):10039-49
No comments: Submit comment
No validations: Submit validation data