ABIN633675

antibody from antibodies-online

Targeting: CACNA2D1 CACNA2, CACNL2A, LINC01112, lncRNA-N3, MHS3

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633675 - Provider product page
Provider: antibodies-online
Product name: anti-Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: CACNA2 D1 antibody was raised using the middle region of CACNA2 1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
Description: Affinity purified
Reactivity: Human, Mouse, Rat, Canine
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CACNA2D1 protein structure - ABIN633675 shown in red.