HPA051899

C18orf25 antibody from Atlas Antibodies
Ark2N, ARKL1, MGC12909, RNF111L1

Antibody data

Product number
HPA051899
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051899, RRID:AB_2681657
Product name
Anti-C18orf25
Provider product page
Atlas Antibodies - HPA051899
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSG
NAPLNEEINIASSDSEVEIVGVQEHARCVHPR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -