H00056246-M01A

MRAP antibody from Abnova Corporation
B27, C21orf61, FALP
No application information provided.

Antibody data

Product number
H00056246-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056246-M01A, RRID:AB_1575604
Product name
MRAP monoclonal antibody (M01A), clone 3D12
Provider product page
Abnova Corporation - H00056246-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MRAP.
Antigen sequence
RNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLAT
SQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQT
HPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Isotype
IgM
Antibody clone number
3D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -