ABIN635968

antibody from antibodies-online

Targeting: TMED1 Il1rl1l, IL1RL1LG, MGC1270, p24g1, p24gamma1, ST2L

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635968 - Provider product page
Provider: antibodies-online
Product name: anti-Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

TMED1 protein structure - ABIN635968 shown in red.