Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503499 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Testis-Specific serine Kinase 2 (TSSK2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSSK2 antibody: synthetic peptide directed towards the middle region of human TSSK2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASF
KREGE GKYRAECKLD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm.
Hao Z, Jha KN, Kim YH, Vemuganti S, Westbrook VA, Chertihin O, Markgraf K, Flickinger CJ, Coppola M, Herr JC, Visconti PE
Molecular human reproduction 2004 Jun;10(6):433-44
Molecular human reproduction 2004 Jun;10(6):433-44
No comments: Submit comment
No validations: Submit validation data