ABIN634942

antibody from antibodies-online

Targeting: BPNT2 FLJ20421, gPAPP, IMPA3, IMPAD1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN634942 - Provider product page
Provider: antibodies-online
Product name: anti-Inositol Monophosphatase Domain Containing 1 (IMPAD1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: IMPAD1 antibody was raised using the middle region of IMPAD1 corresponding to a region with amino acids TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

BPNT2 protein structure - ABIN634942 shown in red.