ABIN406031

CHST14 antibody from antibodies-online
D4ST-1, D4ST1, HD4ST

Antibody data

Product number
ABIN406031
Provider
antibodies-online
Product name
anti-Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406031
Antibody type
Polyclonal
Antigen
The immunogen for anti-CHST14 antibody: synthetic peptide directed towards the middle region of human CHST14
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLR
YLVDE DPERMNEHWM
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -