H00003029-M01

HAGH antibody from Abnova Corporation
GLO2, GLXII, HAGH1
No application information provided.

Antibody data

Product number
H00003029-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003029-M01, RRID:AB_1575763
Product name
HAGH monoclonal antibody (M01), clone 4D3
Provider product page
Abnova Corporation - H00003029-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HAGH.
Antigen sequence
GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIRE
KLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREK
TVQQHAGETDPVTTMRAVRREKDQFKMPRD
Isotype
IgG
Antibody clone number
4D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -