Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405743 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Contactin Associated Protein 1 (CNTNAP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CNTNAP1 antibody: synthetic peptide directed towards the N terminal of human CNTNAP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGD
RVDSW TPFYQRGHNS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nogo-A at CNS paranodes is a ligand of Caspr: possible regulation of K(+) channel localization.
Nie DY, Zhou ZH, Ang BT, Teng FY, Xu G, Xiang T, Wang CY, Zeng L, Takeda Y, Xu TL, Ng YK, Faivre-Sarrailh C, Popko B, Ling EA, Schachner M, Watanabe K, Pallen CJ, Tang BL, Xiao ZC
The EMBO journal 2003 Nov 3;22(21):5666-78
The EMBO journal 2003 Nov 3;22(21):5666-78
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting